PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G412300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MIKC_MADS
Protein Properties Length: 270aa    MW: 29924.8 Da    PI: 9.4483
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G412300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.78.7e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a++ifss+g+lyeyss
  Sevir.5G412300.1.p  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALVIFSSRGRLYEYSS 59
                        79***********************************************96 PP

2K-box107.12.1e-35831749100
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          + + +++ qqe+akL ++i++Lq+++Rhl+Ge++++++ keL+++e++Le+++ +iRskK+elll++ie++qk+e +lq+en+ Lr+k++
  Sevir.5G412300.1.p  83 IDVNSHQYFQQEAAKLHQQIQTLQNSNRHLMGESIGNMTAKELKSIESRLERGIGRIRSKKHELLLAEIEYMQKREADLQSENMFLRAKVA 173
                         566889***********************************************************************************98 PP

               K-box 100 e 100
                         e
  Sevir.5G412300.1.p 174 E 174
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
CDDcd002656.54E-46275No hitNo description
SuperFamilySSF554552.49E-32274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-32323IPR002100Transcription factor, MADS-box
PfamPF003197.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-323859IPR002100Transcription factor, MADS-box
PfamPF014863.6E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.91188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090376Biological Processseed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALVIFSS RGRLYEYSSN  60
SVRSTIERYK KASASTSGTA PVIDVNSHQY FQQEAAKLHQ QIQTLQNSNR HLMGESIGNM  120
TAKELKSIES RLERGIGRIR SKKHELLLAE IEYMQKREAD LQSENMFLRA KVAEVERAEQ  180
EAAEDQQMAP PPVGATTATT ELQALPASFD PRGYYLQAQA SMLAAASAAS SSSSQHHPQL  240
GQEHHHLQTA LHLGYHIKVD SAAASKGFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q7e-21173173Myocyte-specific enhancer factor 2B
1tqe_R7e-21173173Myocyte-specific enhancer factor 2B
1tqe_S7e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.10.0PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.10.0PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-136MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLK3XKX80.0K3XKX8_SETIT; Uncharacterized protein
STRINGSi002551m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.12e-86MIKC_MADS family protein